Bacterial taxon 1392858
Locus CO715_20245
Protein ATI07847.1
pyrroline-5-carboxylate reductase
Escherichia coli M12
Length 269 aa, Gene n/a, UniProt n/a
>ATI07847.1|Escherichia coli M12|pyrroline-5-carboxylate reductase
MEKKIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAALHDQFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAGITLDQLARALGHDRKIIRAMPNTPALVNAGMTSVTPNALVTPEDTADVLNIFRCFGEAEVIAEPMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHPGALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKLSKS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.72 | 3.9e-8 | ●●○○○ -1.9 | -1.8992141564786678 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.49 | 6.4e-6 | ●●○○○ -1.22 | -1.2244529463978506 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)