Bacterial taxon 1392858
Locus CO715_11785
Protein ATI06326.1
quinol monooxygenase YgiN
Escherichia coli M12
Length 104 aa, Gene n/a, UniProt n/a
>ATI06326.1|Escherichia coli M12|quinol monooxygenase YgiN
MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPGI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.04 | 0.011 | ○○○○○ 0.12 | 0.1200619694218116 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.45 | 0.0038 | ○○○○○ 1.06 | 1.0566739273849497 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)