Bacterial taxon 1392858
Locus CO715_12575
Protein ATI06467.1
reactive intermediate/imine deaminase
Escherichia coli M12
Length 129 aa, Gene n/a, UniProt n/a
>ATI06467.1|Escherichia coli M12|reactive intermediate/imine deaminase
MKKIIETQRAPDAIGPYVQGVDLGSMVFTSGQIPVCPQTGEIPADVQDQARLSLENVKAIVVAAGLSVGDIIKMTVFITDLNDFATINEVYKQFFDEHQATYPTRSCVQVARLPKDVKLEIEAIAVRSA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.12 | 2.0e-11 | ●●○○○ -1.57 | -1.5655891796947385 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.74 | 0.0017 | ○○○○○ 0.18 | 0.18265577369646993 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)