Bacterial taxon 1392858
Locus CO715_16695
Protein ATI07210.1
rhodanese-like domain-containing protein YgaP
Escherichia coli M12
Length 174 aa, Gene n/a, UniProt n/a
>ATI07210.1|Escherichia coli M12|rhodanese-like domain-containing protein YgaP
MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRREQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQPLPLMRQVQIAAGGLILIGVILGYTVNSGFFLLSGFVGAGLLFAGISGFCGMARLLDKMPWNQRA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.33 | 6.5e-28 | ○○○○○ 1.03 | 1.0328882817605796 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.34 | 6.3e-29 | ○○○○○ 1.03 | 1.0333055737890773 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)