Bacterial taxon 1392858
Locus CO715_15490
Protein ATI06991.1
ribonuclease E activity regulator RraA
Escherichia coli M12
Length 161 aa, Gene n/a, UniProt n/a
>ATI06991.1|Escherichia coli M12|ribonuclease E activity regulator RraA
MKYDTSELCDIYQEDVNVVEPLFSNFGGRASFGGQIITVKCFEDNGLLYDLLEQNGRGRVLVVDGGGSVRRALVDAELARLAVQNEWEGLVIYGAVRQVDDLEELDIGIQAMAAIPVGAAGEGIGESDVRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.52 | 4.5e-10 | ●●○○○ -1.23 | -1.230920972839565 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -6.9 | 2.2e-10 | ●○○○○ -0.89 | -0.8941663058419029 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)