Bacterial taxon 1392858
Locus CO715_10670
Protein ATI06119.1
ribonuclease T
Escherichia coli M12
Length 215 aa, Gene n/a, UniProt n/a
>ATI06119.1|Escherichia coli M12|ribonuclease T
MSDNAQLTGLCDRFRGFYPVVIDVETAGFNAKTDALLEIAAITLKMDEQGWLMPDTTLHFHVEPFVGANLQPEALAFNGIDPNDPDRGAVSEYEALHEIFKVVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASLKRNPFHPFATFDTAALAGLALGQTVLSKACQTAGMDFDSTQAHSALYDTERTAVLFCEIVNRWKRLGGWPLPAAEEV
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.85 | 5.4e-6 | ●●○○○ -1.93 | -1.9259208463025221 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.06 | 0.00018 | ●●○○○ -1.55 | -1.5520271887685624 | 29101196 |
Retrieved 2 of 2 entries in 1.4 ms
(Link to these results)