Bacterial taxon 1392858
Locus CO715_01800
Protein ATI04575.1
ribose-5-phosphate isomerase
Escherichia coli M12
Length 105 aa, Gene n/a, UniProt n/a
>ATI04575.1|Escherichia coli M12|ribose-5-phosphate isomerase
MQPVFFIKKRTGAMGGHVAGTAGFCVAVPAFYSWSMSEGIDKETRSSERTDYPHYASEVALAFGSRVVGLELAKMIVDAWLGAQYEGGSHQQRVEAITAIEQRRN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.7 | 0.016 | ○○○○○ 0.4 | 0.40089950460077883 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.81 | 1.3e-9 | ○○○○○ 0.92 | 0.9231404782656786 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)