Bacterial taxon 1392858
Locus CO715_04000
Protein ATI04976.1
ribulose-phosphate 3-epimerase
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI04976.1|Escherichia coli M12|ribulose-phosphate 3-epimerase
MKQYLIAPSILSADFARLGEDTAKALAAGADVVHFDVMDNHYVPNLTIGPMVLKSLRNYGITAPIDVHLMVKPVDRIVPDFAAAGASIITFHPEASEHVDRTLQLIKENGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPQTLDKLREVRRRIDESGFDIRLEVDGGVKVNNIGEIAAAGADMFVAGSAIFDQPDYKKVIDEMRSELAKVSHE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.36 | 2.7e-10 | ●●●○○ -2.03 | -2.03253895958369 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -11.98 | 1.5e-9 | ●●○○○ -1.95 | -1.9524188901121273 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)