Bacterial taxon 1392858
Locus CO715_22645
Protein ATI08279.1
right origin-binding protein
Escherichia coli M12
Length 289 aa, Gene n/a, UniProt n/a
>ATI08279.1|Escherichia coli M12|right origin-binding protein
MDQAGIIRDLLIWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDVTGHAIGAYIRARRLSKSAVALRLTARPILDIALQYRFDSQQTFTRAFKKQFAQTPALYRRSPEWSAFGIRPPLRLGEFTMPEHKFVTLEDTPLIGVTQSYSCSLEQISDFRHEMRYQFWHDFLGNAPTIPPVLYGLNETRPSQDKDDEQEVFYTTALAQDQADGYVLTGHPVMLQGGEYVMFTYEGLGTGVQEFILTVYGTCMPMLNLTRRKGQDIERYYPAEDAKAGDRPINLRCELLIPIRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -0.9 | 0.0084 | ○○○○○ 0.36 | 0.3593789477652554 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 0.76 | 0.038 | ○○○○○ 0.7 | 0.7042708093186231 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)