Bacterial taxon 1392858
Locus CO715_14220
Protein ATI06760.1
RNA 2',3'-cyclic phosphodiesterase
Escherichia coli M12
Length 176 aa, Gene n/a, UniProt n/a
>ATI06760.1|Escherichia coli M12|RNA 2',3'-cyclic phosphodiesterase
MSEPQRLFFAIDLPAEIREQIIHWRATHFPPDAGRPVAADNLHLTLAFLGEVSAEKEKALSLLAGRIRQPGFTLTLDDAGQWLRSRVVWLGMRQPPRGLIQLANMLRSQAAHSGCFQSNRPFHPHITLLRDASEAVTIPPPGFNWSYTVTEFTLYASSFARGRTRYTPLKRWALTQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.65 | 1.9e-5 | ●●○○○ -1.05 | -1.0496075864573047 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.19 | 7.1e-5 | ●○○○○ -0.95 | -0.9530044818600818 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)