Bacterial taxon 1392858
Locus CO715_02935
Protein ATI04783.1
RpoE-regulated lipoprotein
Escherichia coli M12
Length 191 aa, Gene n/a, UniProt n/a
>ATI04783.1|Escherichia coli M12|RpoE-regulated lipoprotein
MKSLRLMLCAMPLMLTGCSTMSSVNWSAANPWNWFGSSTKVSEQGVGELTASTPLQEQPIADALDGDYRLRSGMKTANGNVVRFFEVMKGDNVAMVINGDQGMISRIDVLDSDIPADTGVKIGTPFSDLYSKAFGNCQKADGDDNRAVECKAEGSQHISYQFSGEWSGPEGLMPSDDTLKNWKVSKIIWRR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.91 | 2.2e-33 | ●●○○○ -1.31 | -1.3120842723823722 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -4.69 | 5.4e-17 | ●○○○○ -0.43 | -0.43201538428067526 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)