Bacterial taxon 1392858
Locus CO715_12790
Protein ATI06507.1
SCP2 domain-containing protein
Escherichia coli M12
Length 174 aa, Gene n/a, UniProt n/a
>ATI06507.1|Escherichia coli M12|SCP2 domain-containing protein
MLDKLRSRIVHLGPSLLSVPVKLTPFALKRQVLEQVLSWQFRQALDDGELEFLEGRWLSIHVRDIDLQWFTSVVNGKLVVSQNAQADVSFSADASDLLMIAARKQDPDTLFFQRRLVIEGDTELGLYVKNLMDAIELEQMPKALRMMLLQLADFVEAGMKTAPETKQTSVGEPC
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.38 | 2.0e-35 | ○○○○○ 1.25 | 1.2513406586791374 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.3 | 5.4e-83 | ○○○○○ 1.65 | 1.6527755900939465 | 29101196 |
Retrieved 2 of 2 entries in 0.3 ms
(Link to these results)