Bacterial taxon 1392858
Locus CO715_06775
Protein ATI05445.1
septum site-determining protein MinD
Escherichia coli M12
Length 270 aa, Gene n/a, UniProt n/a
>ATI05445.1|Escherichia coli M12|septum site-determining protein MinD
MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQGDATLNQALIKDKRTENLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRRAENGEEPIKEHLLLTRYNPGRVSRGDMLSMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVILDINADAGKAYADTVERLLGEERPFRFIEEEKKGFLKRLFGG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.07 | 6.5e-21 | ●●○○○ -1.35 | -1.3471368027761808 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.85 | 0.014 | ○○○○○ 0.16 | 0.15949606611484635 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)