Bacterial taxon 1392858
Locus CO715_12345
Protein ATI06426.1
siderophore-interacting protein
Escherichia coli M12
Length 254 aa, Gene n/a, UniProt n/a
>ATI06426.1|Escherichia coli M12|siderophore-interacting protein
MNNSPRYPQRVRNDLRFRELTVLRAERISAGFQRIVLGGEALDGFTSRGFDDHSKLFFPQSDAHFVPPTVTEEGIVWPEGPRPPSRDYTPLYDELRHELAIDFFIHEGGVASSWAMQAQPGDKLTVAGPRGSLVMPEDYAYQLYVCDESGMPALRRRLETLSKLAVKPQVSALVSVRDHACQDYLAHLDGFNIEWLAHDEQAVDARLAQMQIPADDYFIWITGEGKVVKNLSRRFEAEQYDPQRVRAAAYWHAK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.14 | 4.9e-13 | ●●○○○ -1.99 | -1.9866368364489404 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.21 | 5.9e-13 | ●●○○○ -1.17 | -1.1670752924794137 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)