Bacterial taxon 1392858
Locus CO715_05700
Protein ATI05265.1
single-stranded DNA-binding protein
Escherichia coli M12
Length 140 aa, Gene n/a, UniProt n/a
>ATI05265.1|Escherichia coli M12|single-stranded DNA-binding protein
MTAQIAAYGRLVADPQLKTTSKGTQMTMASMAVPLPCSQADDGTAPMWLSVLAFGRQADALAKHHKGELVSVAGNMQVSQWTGQNGETRQGWQVIADSVISARTARPGGKKGQQGQATDALNRAKQQSGNDDPYGDNIPF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.33 | 6.4e-11 | ○○○○○ 0.82 | 0.8229903914262251 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.07 | 1.3e-23 | ○○○○○ 0.98 | 0.9786403180558757 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)