Bacterial taxon 1392858
Locus CO715_10380
Protein ATI06068.1
spermidine export protein MdtI
Escherichia coli M12
Length 109 aa, Gene n/a, UniProt n/a
>ATI06068.1|Escherichia coli M12|spermidine export protein MdtI
MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGIDLSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.12 | 1.8e-5 | ●●○○○ -1.15 | -1.1476712131542695 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.7 | 9.8e-5 | ●●○○○ -1.06 | -1.0602485331839966 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)