Bacterial taxon 1392858
Locus CO715_07200
Protein ATI05522.1
spermidine/putrescine ABC transporter permease PotB
Escherichia coli M12
Length 285 aa, Gene n/a, UniProt n/a
>ATI05522.1|Escherichia coli M12|spermidine/putrescine ABC transporter permease PotB
MKNTSKFQNVVIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYTRLLDPLYFEVLLHSLNMALIATLACLVLGYPFAWFLAKLPHKVRPLLLFLLIVPFWTNSLIRIYGLKIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPLLEAARDLGASKLQTFIRIIIPLTMPGIIAGCLLVMLPAMGLFYVSDLMGGAKNLLIGNVIKVQFLNIRDWPFGAATSITLTIVMGLMLLVYWRASRLLNKKVELE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -7.99 | 1.2e-28 | ●●○○○ -1.12 | -1.1217991073874105 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.06 | 1.8e-35 | ●○○○○ -0.93 | -0.927341022107472 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)