Bacterial taxon 1392858
Locus CO715_18700
Protein ATI07566.1
SsrA-binding protein
Escherichia coli M12
Length 160 aa, Gene n/a, UniProt n/a
>ATI07566.1|Escherichia coli M12|SsrA-binding protein
MTKKKAHKPGSATIALNKRARHEYFIEEEFEAGLALQGWEVKSLRAGKANISDSYVLLRDGEAFLFGANITPMAVASTHVVCDPTRTRKLLLNQRELDSLYGRVNREGYTVVALSLYWKNAWCKVKIGVAKGKKQHDKRSDIKEREWQVDKARIMKNAHR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.29 | 3.1e-25 | ●●○○○ -1.39 | -1.3915784038111885 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -2.41 | 0.00031 | ○○○○○ 0.04 | 0.04432346624947497 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)