Bacterial taxon 1392858
Locus CO715_02980
Protein ATI04792.1
sulfate ABC transporter permease subunit CysW
Escherichia coli M12
Length 291 aa, Gene n/a, UniProt n/a
>ATI04792.1|Escherichia coli M12|sulfate ABC transporter permease subunit CysW
MTEVTQLKRYGARPINWGKWFLIGIGMLVSAFILLVPMIYIFVQAFSKGLMPVLQNLADPDMLHAIWLTVMIALIAVPVNLVFGILLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLVYLLFYGSNGPLGGWLDEHNLQIMFSWPGMVLVTIFVTCPFVVRELVPVMLSQGSQEDEAAILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIELLEQDYNTVGSFTAAALLTLMAIITLFLKSMLQWRLENQEKRAQQEEHHEH
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.42 | 0.0073 | ●○○○○ -0.79 | -0.7929729889312054 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 3.87 | 0.025 | ○○○○○ 1.35 | 1.354411789718075 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)