Bacterial taxon 1392858
Locus CO715_13595
Protein ATI06648.1
thermosensitive gluconokinase
Escherichia coli M12
Length 187 aa, Gene n/a, UniProt n/a
>ATI06648.1|Escherichia coli M12|thermosensitive gluconokinase
MAGESFILMGVSGSGKTLIGSKVAALLSAKFIDGDDLHPAKNIDKMSQGIPLSDEDRLPWLERLNDASYSLYKKNETGFIVCSSLKKQYRDILRKGSPHVHFLWLDGDYETILARMQRRAGHFMPVALLKSQFEALERPQADEQDIVRIDINHDIANVTEQCRQAVLAIRQNRICAKEGSASDQRCE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.83 | 0.00014 | ○○○○○ 0.37 | 0.37377552274842685 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.98 | 1.2e-21 | ○○○○○ 0.96 | 0.9584016546737361 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)