Bacterial taxon 1392858
Locus CO715_04295
Protein ATI05034.1
thiamine phosphate synthase
Escherichia coli M12
Length 211 aa, Gene n/a, UniProt n/a
>ATI05034.1|Escherichia coli M12|thiamine phosphate synthase
MYQPDFPPVPFHLGLYPVVDSAQWIERLLDAGVRTLQLRIKDRRDEEVEADVVAAITLGRRYNARLFINDYWRLAIKHQAYGVHLGQEDLQATDLSAIRAAGLRLGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLEQLARHVERLADYPTVAIGGISLARAPAVMATGVGSIAVVSAITQAADWRLATAQLLEIAGVGDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.35 | 2.8e-15 | ●●●○○ -2.03 | -2.0312870834981966 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -3.46 | 5.4e-7 | ●○○○○ -0.17 | -0.17496349472607825 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)