Bacterial taxon 1392858
Locus CO715_01330
Protein ATI04493.1
transcriptional regulator
Escherichia coli M12
Length 141 aa, Gene n/a, UniProt n/a
>ATI04493.1|Escherichia coli M12|transcriptional regulator
MQLTSFTDYGLRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGKNGGIRLGKPASAIRIGDVVRELEPLSLVNCSSEFCHITPACRLKQALSKAVQSFLTELDNYTLADLVEENQPLYKLLLVE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.03 | 0.0016 | ●●○○○ -1.34 | -1.3369131480779868 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.27 | 9.3e-14 | ●○○○○ -0.14 | -0.13636398209003892 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)