Bacterial taxon 1392858
Locus CO715_11820
Protein ATI06332.1
transcriptional regulator
Escherichia coli M12
Length 160 aa, Gene n/a, UniProt n/a
>ATI06332.1|Escherichia coli M12|transcriptional regulator
MTNLTLDVNIIDFPSIPVAMLPHRCSPELLNYSVAKFIMWRKETGLSPVNQSQTFGVAWDDPATTAPEAFRFDICGSVSEPIPDNRYGVSNGELTGGRYAVARHVGELDDISHTVWGIIRHWLPASGEKMRKAPILFHYTNLAEGVTEQRLETDVYVPLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.42 | 0.00053 | ○○○○○ 0.84 | 0.8426031167656182 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.78 | 5.3e-6 | ○○○○○ 0.92 | 0.9175070358809594 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)