Bacterial taxon 1392858
Locus CO715_12420
Protein ATI06439.1
transcriptional regulator
Escherichia coli M12
Length 138 aa, Gene n/a, UniProt n/a
>ATI06439.1|Escherichia coli M12|transcriptional regulator
MIAIADILQAGEKLTAVAPFLAGIQNEEQYAQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGGIAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10.82 | 8.5e-25 | ●●○○○ -1.71 | -1.7114327436546926 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.51 | 3.9e-26 | ●●○○○ -1.44 | -1.4381064649886843 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)