Bacterial taxon 1392858
Locus CO715_16690
Protein ATI07209.1
transcriptional regulator
Escherichia coli M12
Length 99 aa, Gene n/a, UniProt n/a
>ATI07209.1|Escherichia coli M12|transcriptional regulator
MTELAQLQASAEQAAALLKAMSHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIKNEAVNAIIATLKNVYCP
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.28 | 4.0e-17 | ○○○○○ 0.81 | 0.8136013207850263 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.83 | 1.7e-75 | ○○○○○ 1.14 | 1.1367939968565124 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)