Bacterial taxon 1392858
Locus CO715_20570
Protein ATI07907.1
transcriptional regulator
Escherichia coli M12
Length 212 aa, Gene n/a, UniProt n/a
>ATI07907.1|Escherichia coli M12|transcriptional regulator
MTQGAVKTTGKRSRAVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKAFREDFAPLAAIKEYIRLKLEVSRDYPQASRLFCMEMLAGAPLLMDELTGDLKALIDEKSALIAGWVKSGKLAPIDPQHLIFMIWASTQHYADFAPQVEAVTGATLRDEVFFNQTVENVQRIIIEGIRPR
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.32 | 2.8e-31 | ●●○○○ -1.19 | -1.1902350000610369 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -3.88 | 2.0e-10 | ●○○○○ -0.26 | -0.2623861746963511 | 29101196 |
Retrieved 2 of 2 entries in 1 ms
(Link to these results)