Bacterial taxon 1392858
Locus CO715_21785
Protein ATI08128.1
transcriptional regulator
Escherichia coli M12
Length 248 aa, Gene n/a, UniProt n/a
>ATI08128.1|Escherichia coli M12|transcriptional regulator
MEQAHTQLIAQLNERILAADNTPLYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVSRITVRKAMQALEEEGVVTRSRGYGTQINNIFEYSLKEARGFSQQVVLRGKKPDTLWVNKRVVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEAVSIEESWVPAHLIHDVDAIGISLYDYFRSQHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQVALDQQQRPIEYSISHCRSDLYVFVCEE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.61 | 5.6e-5 | ●●○○○ -1.46 | -1.459597004456317 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -1.98 | 0.042 | ○○○○○ 0.13 | 0.1332066683194898 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)