Bacterial taxon 1392858
Locus CO715_23190
Protein ATI08373.1
transcriptional regulator
Escherichia coli M12
Length 260 aa, Gene n/a, UniProt n/a
>ATI08373.1|Escherichia coli M12|transcriptional regulator
MSQQRPDRIKQMLHYLWQHRHLSTQQAMELFGYAEATVRRDFQYIVNQYPGMIRGHGCLDFDDSTDDKEYVFDVKRTLQSVAKREIAALARTMIKDGDCFFLDSGSTCLELAKCLADARVKVICNDIKIANELGCFPHVESYIIGGLIRPGYFSVGESLALEMINAFSVERAFISCDALSLETGITNATMFEVGVKTRIIQRSREVILMADHSKFDAVEPHAVATLSCIKTIISDSGLPETIAQRYQRAGCQLFLPHSIK
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.63 | 1.2e-7 | ●○○○○ -0.63 | -0.6285599297031026 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.11 | 1.4e-10 | ○○○○○ 1.61 | 1.6129242013724139 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)