Bacterial taxon 1392858
Locus CO715_16900
Protein ATI07246.1
transcriptional regulator GutM
Escherichia coli M12
Length 119 aa, Gene n/a, UniProt n/a
>ATI07246.1|Escherichia coli M12|transcriptional regulator GutM
MVSALITVAVIAWCAQLALGGWQISRFNRAFDTLCQQGRVGVGRSSGRFKPRVVVVIALDDQQRIVDTLFMKGLTVFARPQKIPAITGMYAGDLQPDVIFPHDPLSQNALSLALKLKRG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.78 | 9.8e-9 | ●●○○○ -1.49 | -1.4940235968073792 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.36 | 1.1e-7 | ●●○○○ -1.41 | -1.4066009168371063 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)