Bacterial taxon 1392858
Locus CO715_00035
Protein ATI04262.1
tRNA (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ
Escherichia coli M12
Length 246 aa, Gene n/a, UniProt n/a
>ATI04262.1|Escherichia coli M12|tRNA (cytosine(32)/uridine(32)-2'-O)-methyltransferase TrmJ
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAHIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGLTNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQENGEQVEHEETPYPLVDDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQQNKGNKAE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.17 | 0.0052 | ●●○○○ -1.37 | -1.3680014042010669 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.18 | 0.0081 | ●●○○○ -1.16 | -1.1599813279949522 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)