Bacterial taxon 1392858
Locus CO715_03480
Protein ATI04880.1
tRNA pseudouridine(38-40) synthase TruA
Escherichia coli M12
Length 270 aa, Gene n/a, UniProt n/a
>ATI04880.1|Escherichia coli M12|tRNA pseudouridine(38-40) synthase TruA
MSDQQQPPVYKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTDAGVHGTGQVVHFETTAQRKDAAWTLGVNANLPGDIAVRWVKAVPDDFHARFSATARRYRYIIYNHRLRPAVLSKGVTHFYEPLDAERMHRAAQCLLGENDFTSFRAVQCQSRTPWRNVMHINVTRHGPYVVVDIKANAFVHHMVRNIVGSLMEVGAHNQPESWIAELLAAKDRTLAAATAKAEGLYLVAVDYPDRYDLPKPPMGPLFLAD
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -10 | 0.0068 | ●●○○○ -1.54 | -1.539508427913631 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.61 | 2.2e-6 | ●●○○○ -1.46 | -1.459805650470566 | 29101196 |
Retrieved 2 of 2 entries in 1.2 ms
(Link to these results)