Bacterial taxon 1392858
Locus CO715_17340
Protein ATI07326.1
tRNA pseudouridine(65) synthase TruC
Escherichia coli M12
Length 260 aa, Gene n/a, UniProt n/a
>ATI07326.1|Escherichia coli M12|tRNA pseudouridine(65) synthase TruC
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGVLLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDKGPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSKHGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLLPENERVEFSAPSGQDGEISS
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 5.14 | 7.5e-9 | ○○○○○ 1.62 | 1.6181403517286355 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 5.41 | 3.4e-9 | ○○○○○ 1.68 | 1.675726651661321 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)