Bacterial taxon 1392858
Locus CO715_11200
Protein ATI06218.1
TVP38/TMEM64 family protein
Escherichia coli M12
Length 236 aa, Gene n/a, UniProt n/a
>ATI06218.1|Escherichia coli M12|TVP38/TMEM64 family protein
MNAERKFLFACLIFALLIYAIHAFGLFDLLTDLPHLQTLIRQSGLFGYSLYILLFIIATLFLLPGSILVIAGGIVFGPLLGTLLSLIAATLASSCSFLLARWLGRDLLLKYVGHSHTFQAIEKGIARNGIDFLILTRLIPLFPYNIQNYAYGLTTIAFWPYTLISALTTLPGIVIYTVMASDLANEGITLRFILQLCLAGLALFILVQLAKLYARHKHVDLSASRRSPLTHPKNEG
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.58 | 0.045 | ○○○○○ 0.67 | 0.666714526753828 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 1.14 | 0.00016 | ○○○○○ 0.78 | 0.7829303566904438 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)