Bacterial taxon 1392858
Locus CO715_09430
Protein ATI05913.1
two-component system response regulator KdpE
Escherichia coli M12
Length 225 aa, Gene n/a, UniProt n/a
>ATI05913.1|Escherichia coli M12|two-component system response regulator KdpE
MTNVLIVEDEQAIRRFLRTALEGDRMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSAVPVIVLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRHSATTTPDPLVKFSNVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFML
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.48 | 2.6e-10 | ●●○○○ -1.22 | -1.223409716326606 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.23 | 5.3e-13 | ●●○○○ -1.17 | -1.171039566750142 | 29101196 |
Retrieved 2 of 2 entries in 1.3 ms
(Link to these results)