Bacterial taxon 1392858
Locus CO715_07955
Protein ATI05650.1
type 1 fimbrial protein subunit FimA
Escherichia coli M12
Length 180 aa, Gene n/a, UniProt n/a
>ATI05650.1|Escherichia coli M12|type 1 fimbrial protein subunit FimA
MKLRFISSALAAALFAATGSYAAVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRYE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -0.44 | 0.033 | ○○○○○ 0.45 | 0.4545215302627362 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 1.82 | 1.7e-21 | ○○○○○ 0.93 | 0.9262701684794115 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)