Bacterial taxon 1392858
Locus CO715_17170
Protein ATI07295.1
type I-E CRISPR-associated protein Cse2/CasB
Escherichia coli M12
Length 178 aa, Gene n/a, UniProt n/a
>ATI07295.1|Escherichia coli M12|type I-E CRISPR-associated protein Cse2/CasB
MSIVKEEHKATLRKWHEELQEKRGNRASLRRSTTVNDVCLSEGFRSLLMQTHTLWKIEAQEWRFTALALVAAVSANVKAIDERQPFAAQLAAVMSEGRFTRLSAVKTPDDLLRQLRRAVKLLNGSVNLISLAEDIFRWCQESDDLLNHHRRQQRPTEFIRIRWALEYYQAGDADNEQN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -7.69 | 4.0e-24 | ●●○○○ -1.06 | -1.0585793650700057 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -6.46 | 3.0e-21 | ●○○○○ -0.8 | -0.8019447675439064 | 29101196 |
Retrieved 2 of 2 entries in 0.8 ms
(Link to these results)