Bacterial taxon 1392858
Locus CO715_12155
Protein ATI06395.1
type II secretion system protein GspI
Escherichia coli M12
Length 123 aa, Gene n/a, UniProt n/a
>ATI06395.1|Escherichia coli M12|type II secretion system protein GspI
MKRGFTLLEVMIALAIFALAATAVLQIASGALNNQQVLEEKTVAGWVAENQTALLYLMTREQRAVRHQGESDMAGSRWYWRTIPLNTGNVLLQAVDIEVSLHDDFSPVIQSRRAWFSAVGGQQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -8.93 | 3.5e-28 | ●●○○○ -1.32 | -1.31792636078134 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.51 | 0.00067 | ●●○○○ -1.23 | -1.2302950347968185 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)