Bacterial taxon 1392858
Locus CO715_23570
Protein ATI08427.1
ureidoglycolate lyase
Escherichia coli M12
Length 160 aa, Gene n/a, UniProt n/a
>ATI08427.1|Escherichia coli M12|ureidoglycolate lyase
MKLQVLPLSQEAFSAYGDVIETQKRDFFHINNGLVERYHDLALVEILEQDRTLISINRAQPANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHRNVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.04 | 0.00095 | ○○○○○ 0.97 | 0.9709204155286677 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.38 | 0.00022 | ○○○○○ 1.04 | 1.042694644430276 | 29101196 |
Retrieved 2 of 2 entries in 0.9 ms
(Link to these results)