Bacterial taxon 1392858
Locus CO715_04635
Protein ATI05085.1
very short patch repair endonuclease
Escherichia coli M12
Length 156 aa, Gene n/a, UniProt n/a
>ATI05085.1|Escherichia coli M12|very short patch repair endonuclease
MADVHDKATRSKNMRAIATRDTAIEKRLASLLTGLGLAFRVQDASLPGRPDFVVDEYRCVIFTHGCFWHHHHCYLFKVPATRTEFWLEKIGKNVERDRRDISRLQELGWRVLIVWECALRGREKLTDEALSERLEEWICGEGASAQIDTQGIHLLA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -8.06 | 0.0095 | ●●○○○ -1.14 | -1.1364043283848309 | 29101196 |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -5.96 | 0.029 | ●○○○○ -0.7 | -0.6967871763624802 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)