Bacterial taxon 1392858
Locus CO715_01720
Protein ATI04559.1
VOC family protein
Escherichia coli M12
Length 147 aa, Gene n/a, UniProt n/a
>ATI04559.1|Escherichia coli M12|VOC family protein
MPLSPYLSFAGNCADAIAYYQRTLGAELIYKISFGEMPKSAQDSAENCPSGMQFPDTAIAHANVRIAGSDIMMSDAIPSGKASYSGFTLVLDSQQVEEGKRWFDNLAANGKIEMAWQETFWAHGFGKVTDKFGVPWMINVVKQQPTQ
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 2.64 | 6.3e-6 | ○○○○○ 1.1 | 1.096733962120731 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 9.54 | 1.1e-7 | ○○○○○ 2.54 | 2.5368087524663716 | 29101196 |
Retrieved 2 of 2 entries in 0.7 ms
(Link to these results)