Bacterial taxon 1392858
Locus CO715_18335
Protein ATI07503.1
YggU family protein
Escherichia coli M12
Length 96 aa, Gene n/a, UniProt n/a
>ATI07503.1|Escherichia coli M12|YggU family protein
MSAVTVNDGGLVLRLYIQPKASRDSIVGLHGDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQVVIEKGELGRHKQIKIINPQQIPPEIAALIN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -11.35 | 0.00013 | ●●○○○ -1.82 | -1.822223777220838 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -10.16 | 0.00063 | ●●○○○ -1.57 | -1.5737263742504441 | 29101196 |
Retrieved 2 of 2 entries in 0.4 ms
(Link to these results)