Bacterial taxon 1392858
Locus CO715_00470
Protein ATI04340.1
YhcH/YjgK/YiaL family protein
Escherichia coli M12
Length 155 aa, Gene n/a, UniProt n/a
>ATI04340.1|Escherichia coli M12|YhcH/YjgK/YiaL family protein
MIFGHIAQPDPCRLPAAIEKALDFLRATDFNALEPGVVEIDGKNIYAQIIDLTTRPAEENRPEVHRRYIDIQYLAWGEEKIGIAIDTGNNKVSESLLEQRDIIFYHHCENESFIKMTPGSYAIFFPQDVHRPGCILQTASEIRKIVVKVALTALN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -12.36 | 2.8e-5 | ●●●○○ -2.03 | -2.0333735436406855 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.19 | 0.0014 | ●●○○○ -1.37 | -1.3715483864432978 | 29101196 |
Retrieved 2 of 2 entries in 0.6 ms
(Link to these results)