Bacterial taxon 1392858
Locus CO715_13110
Protein ATI06563.1
YhcH/YjgK/YiaL family protein
Escherichia coli M12
Length 154 aa, Gene n/a, UniProt n/a
>ATI06563.1|Escherichia coli M12|YhcH/YjgK/YiaL family protein
MMMGEVQSLPSAGLHPALQDALTLALAARPQEKAPGRYELQGDNIFMNVMTFNTQSPVEKKAELHEQYIDIQLLLNGEERILFGMAGTARQCEVFHHEDDYQLCSAIENEQTIILKPGMFAVFMPGEPHKPGCVVGEPSEIKKVVVKVKADLMA
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | 0.93 | 0.00021 | ○○○○○ 0.74 | 0.7409925078264227 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | 2.68 | 2.0e-25 | ○○○○○ 1.1 | 1.104453864647939 | 29101196 |
Retrieved 2 of 2 entries in 0.5 ms
(Link to these results)