Bacterial taxon 1392858
Locus CO715_11520
Protein ATI06279.1
YoaH family protein
Escherichia coli M12
Length 59 aa, Gene n/a, UniProt n/a
>ATI06279.1|Escherichia coli M12|YoaH family protein
MFAGLPSLTHEQQQKAVERIQELMAQGMSSGQAIALVAEELRANHSGERIVARFEDEDE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Mouse (Mus musculus BALB/c) | mammary gland | BTO:0000817 | 24 h | not available in this study | -9.65 | 2.1e-6 | ●●○○○ -1.47 | -1.467316906983525 | 29101196 |
| Mouse (Mus musculus BALB/c) | spleen | BTO:0001281 | 24 h | not available in this study | -9.23 | 1.3e-5 | ●●○○○ -1.38 | -1.3796855809990032 | 29101196 |
Retrieved 2 of 2 entries in 1.5 ms
(Link to these results)