Bacterial taxon 155864
Locus Z5127
Protein AAG58840.1
cesD
Escherichia coli O157:H7 str. EDL933
Length 151 aa, Gene n/a, UniProt n/a
>AAG58840.1|Escherichia coli O157:H7 str. EDL933|cesD
MSRKFSSLEDIYDFYQDGGTLASLTNLTQQDLNDLHSYAYTAYQSGDVITARNLFHLLTYLEHWNYDYTLSLGLCHQRLSNHEDAQLCFARCATLVMQDPRASYYSGISYLLVGNKKMAKKAFKACLMWCNEKEKYTTYKENIKKLLGNTE
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 4,682,282 | -4.79 | 0.045 | ●●○○○ -1.66 | -1.6619979196471732 | 21278291 |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)