Bacterial taxon 155864
Locus Z1671
Protein AAG55784.1
curli production assembly/transport component, 2nd curli operon
Escherichia coli O157:H7 str. EDL933
Length 138 aa, Gene n/a, UniProt n/a
>AAG55784.1|Escherichia coli O157:H7 str. EDL933|curli production assembly/transport component, 2nd curli operon
MRVXHAVVLLMLISPLSWAGTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDFGIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVTNDYIVDIANRDGQLQLNVTDRKTGQTSTIQVSGLQNNSTDF
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,546,060 | 0.5 | 0.14 | ○○○○○ 0.71 | 0.7087361597456897 | 21278291 |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)