Bacterial taxon 155864
Locus Z1676
Protein AAG55788.1
curlin major subunit, coiled surface structures; cryptic
Escherichia coli O157:H7 str. EDL933
Length 152 aa, Gene n/a, UniProt n/a
>AAG55788.1|Escherichia coli O157:H7 str. EDL933|curlin major subunit, coiled surface structures; cryptic
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALALQADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFGGGNGAAVDQTASNSTVNVTQVGFGNNATAHQY
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,549,106 | -0.93 | 0.18 | ○○○○○ 0.07 | 0.06716156688580811 | 21278291 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)