Bacterial taxon 155864
Locus Z0693
Protein AAG54892.1
fimbrial Z protein; probable signal transducer
Escherichia coli O157:H7 str. EDL933
Length 231 aa, Gene n/a, UniProt n/a
>AAG54892.1|Escherichia coli O157:H7 str. EDL933|fimbrial Z protein; probable signal transducer
MYQSTIYRPNGKLSAPMRLVTMKPTSVIIMDTHPIIRMSIEVLLQKNSELQIVLKTDDYRITIDYLRTRPVDLIIMDIDLPGTDGFTFLKRIKQIQSTVKVLFLSSKSECFYAGRAIQAGANGFVSKCNDQNDIFHAVQMILSGYTFFPSETLNYIKSNKCSTNSSTVTVLSNREVTILRYLVSGLSNKEIADKLLLSNKTVSAHKSNIYGKLGLHSIVELIDYAKLYELI
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 656,460 | 0.51 | 0.14 | ○○○○○ 0.71 | 0.7147246209579132 | 21278291 |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)