Bacterial taxon 155864
Locus Z2330
Protein AAG56381.1
heat shock protein hslJ
Escherichia coli O157:H7 str. EDL933
Length 140 aa, Gene n/a, UniProt n/a
>AAG56381.1|Escherichia coli O157:H7 str. EDL933|heat shock protein hslJ
MKKVAAFVALSLLMAGCVSNDKIAVTPEQLQHHRFVLESVNGKPVTCDKNPPEISFGEKMMISGSMCNRFSGEGKLSNGELTAKGLAMTRMMCANPQLNELDNTISEMLKEGAQVDLTANQLTLATAKQTLTYKLADLMN
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 2,109,472 | -0.33 | 0.17 | ○○○○○ 0.34 | 0.33888245312070864 | 21278291 |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)