Bacterial taxon 155864
Locus Z2023
Protein AAG56102.1
homolog of Salmonella ATP-binding protein of oligopeptide ABC transport system
Escherichia coli O157:H7 str. EDL933
Length 334 aa, Gene n/a, UniProt n/a
>AAG56102.1|Escherichia coli O157:H7 str. EDL933|homolog of Salmonella ATP-binding protein of oligopeptide ABC transport system
MNAVTEGRKVLLEIADLKVHFEIKDGKQWFWQPPKTLKAVDGVTLRLYEGETLGVVGESGCGKSTFARAIIGLVKATDGHVAWLGKELLGMKPDEWRAVRSDIQMIFQDPLASLNPRMTIGEIIAEPLRTYHPKMSRQEVRERVKAMMLKVGLLPNLINRYPHEFSGGQCQRIGIARALILEPKLIICDEPVSALDVSIQAQVVNLLQQLQREMGLSLIFIAHDLAVVKHISDRVLVMYLGHAVELGTYDEVYHNPLHPYTRALMSAVPIPDPDLEKNKTIQLLEGELPSPINPPSGCVFRTRCPIAGPECAKTRPVLEGSFRHAVSCLKVDPL
| Host |
Tissue |
Tissue Ontology |
Time Post Infection |
Transposon Insertion Site |
Raw Fitness Score |
p-Value |
Fitness z-Score |
Precise fitness z-Score |
Reference |
| Cow (Bos taurus) | feces | BTO:0000440 | 5 days | 1,841,281 | 0.71 | 0.13 | ○○○○○ 0.8 | 0.8029944049988933 | 21278291 |
Retrieved 1 of 1 entries in 1.5 ms
(Link to these results)